PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G0009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 688aa    MW: 75070.3 Da    PI: 8.5109
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G0009genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.36.1e-12184246163
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  e+e kr  r+ +NRe+A+ sRqRKk ++eeLe+kv ++ +  ++L +++     e a+l++++
  Gh_D13G0009 184 EEEEKRKARLLRNRESAQLSRQRKKHYVEELEDKVRTMHSTITDLNNKIAFFMAENATLRQQL 246
                  6899******************************************99999999999988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001705.3E-11184246IPR004827Basic-leucine zipper domain
SMARTSM003383.9E-17184248IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3186249IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.63E-12188246No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-17188247No hitNo description
CDDcd147041.90E-20189240No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MAESPLEPQM GSELESLAIP PMDPLYLSSD LGFPLDENDD FQLTFDDFDE LYFPSDSDHL  60
IMPDSSGAPA FTSESYVERY LNSSSPGLDS FSGPNSSGNS HSPISSLGSG NCGSAVSDDT  120
NVTSPDSGNN MDQKIDVEEL GKRRVSKRKK GNEETDSIKC RRSSSLLTDN YNSNSDNKLN  180
SLSEEEEKRK ARLLRNRESA QLSRQRKKHY VEELEDKVRT MHSTITDLNN KIAFFMAENA  240
TLRQQLSTGG AGGGSAGMCP PQPVPLPMYP PVAYPWMPCG PPYMMKPPGS QVPLIPIPRL  300
KTQQQSRPAS KAKKNESKTK KVASVSVLGM LFFILLFSGL VPIMNVRYDN TPVGSGPGFV  360
GDGFYEVHRG RVLRVDSHLN RSKYSRDAAF SYGDFNISNR VHGRRSESGG ERKETGAQSA  420
PDYIKNVSEP LTASLYVPRN DKLVKIDGNL IIHSVLASEK ALASHKASER KNKETGLAIP  480
KNFSPALAIP NARENGGKHS REYRNPAERP MALSSGSADA LKDHIRSTAA DGKMQQWFRE  540
GVAGPMLSSG MCTEVFQFDA SAPGAIVPAS SVTTESAKNR QNATQLNKGR NRRILHGHPV  600
PLSRSDLNIT QEHVGRNSGK QNLQGNKTAS SMVVSVLIDP REAGDGDMDD MIVPKSLSRI  660
FVVVLLDSVK YVTYSCGLPR SGLHLVTA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142148RRVSKRK
2579592RQNATQLNKGRNRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.160610.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462424.10.0PREDICTED: bZIP transcription factor 17
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0D2V8N80.0A0A0D2V8N8_G
STRINGVIT_08s0040g00870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-155bZIP family protein